Signals Stream
#awards
#awards
40 signals
Sorted by recency
- Government ContractingSep 20, 20262 min · By Defense Signals Desk
DOE Unveils $215M Quantum Genesis Q Contest for Fault-Tolerant Systems
The Department of Energy has launched the $215 million Quantum Genesis Q Competition to accelerate the development of fault-tolerant quantum computers. The initiative aims to secure U.S. leadership in next-generation computing, material science, and strategic cryptography resilience against adversary capabilities.
leadershipawardsquantum computingdepartment of energyfault toleranceRead signal - Government ContractingSep 16, 20262 min · By Defense Signals Desk
NSF Launches $20M Pilot Program to Bridge Deep-Tech Commercialization Gap
The National Science Foundation has committed $20 million to a two-year pilot program led by the University of Central Florida. The initiative aims to accelerate the commercialization of deep-tech innovations developed by small businesses, addressing critical defense transition hurdles.
leadershipawardsnsfdeep techcommercializationRead signal - Government ContractingSep 15, 20262 min · By Defense Signals Desk
Army Intelligence CAIO Warns AI Adoption Stalled by Workforce Skills Gap
The Chief AI Officer for Army Intelligence, Mario Roberts, warned that workforce skills gaps are hampering operational AI deployment across intelligence workflows. Resolving this transition requires aggressive upskilling programs and targeted industry partnerships to modernize tactical data processing.
leadershipawardsarmy intelligenceartificial intelligenceworkforce developmentRead signal - Government ContractingSep 12, 20262 min · By Defense Signals Desk
DOW CIO Issues Policy Instruction to Accelerate Mission Software
Signal ProChief Information Officer Kirsten Davies issued a department-wide policy instruction establishing a comprehensive framework to accelerate, secure, and manage mission software. The directive standardizes software acquisition, DevSecOps practices, and continuous authorization pathways to enhance operational readiness across critical systems.
leadershipawardsdevsecopsmission softwaresoftware acquisitionRead signal - Government ContractingSep 12, 20262 min · By Defense Signals Desk
CISA Releases Updated Insider Threat Guide to Counter Physical and Cyber Vectors
Signal ProCISA has issued an updated Insider Threat Mitigation Guide featuring new case studies and strategies to help defense, critical infrastructure, and government contracting leaders address converging physical and cyber risk vectors.
leadershipawardscisainsider threatcybersecurityRead signal - Government ContractingSep 12, 20262 min · By Defense Signals Desk
Pentagon Expands Maven Smart System to Enterprise Logistics and Budgeting
Signal ProThe Department of Defense is expanding the Maven Smart System beyond intelligence and target processing into core operational workflows, including logistics, force readiness, and fiscal planning. This trajectory underscores a broader Pentagon push to embed AI across enterprise decision-making functions.
leadershipawardscdaoproject mavenmaven smart systemRead signal - CybersecuritySep 11, 20262 min · By Defense Signals Desk
DHS OIG Uncovers Critical Privileged Access Vulnerabilities Across CBP Networks
Signal ProA Department of Homeland Security Office of Inspector General audit revealed that 76,000 Customs and Border Protection network users had access to a highly privileged service account, exposing critical gaps in federal identity governance and Zero Trust implementation.
leadershipawardscbpcybersecuritydhs oigRead signal - Government ContractingSep 11, 20262 min · By Defense Signals Desk
SBA Faces Massive Industry Response Over Proposed Size Standard Overhaul
Signal ProThe Small Business Administration has received extensive public feedback regarding proposed revisions to federal size standards, particularly within IT services under NAICS 541511. The outcome will reshape competitive dynamics, small business set-asides, and subcontracting rules across the defense industrial base.
leadershipawardssbagovernment contractingnaics 541511Read signal - Defense AcquisitionSep 3, 20262 min · By Defense Signals Desk
Army Evaluates Interconnected Sensing Networks in Focused Excursion 26-3
Signal ProThe U.S. Army executed Focused Excursion 26-3 to evaluate resilient, interconnected battlefield sensing networks designed to maintain situational awareness and targeting data streams within highly contested operational environments.
leadershipawardsus armybattlefield sensingjadc2Read signal - Artificial IntelligenceSep 3, 20262 min · By Defense Signals Desk
NSF Selects UCSD and UT Austin to Run National AI Research Resource Hub
Signal ProThe National Science Foundation has established a dedicated operations center for the National AI Research Resource (NAIRR), partnering with UC San Diego and UT Austin. This institutional hub aims to streamline access to high-performance computing, curated datasets, and AI infrastructure across federal, academic, and defense research ecosystems.
leadershipawardsnairrnational science foundationartificial intelligenceRead signal - Government ContractingSep 3, 20262 min · By Defense Signals Desk
NRO, NGA, and Space Force Align Commercial ISR Procurement and Operations
Signal ProThe National Reconnaissance Office, National Geospatial-Intelligence Agency, and U.S. Space Force have resolved jurisdictional overlaps regarding commercial intelligence, surveillance, and reconnaissance. This alignment establishes clear procurement pathways, operational tasking boundaries, and faster data delivery for tactical warfighters.
leadershipawardscommercial isrnrospace forceRead signal - Critical InfrastructureSep 2, 20262 min · By Defense Signals Desk
Coast Guard Launches Dedicated Office to Direct Maritime Cyber Policy
Signal ProThe U.S. Coast Guard has established the Office of Maritime Cybersecurity Policy (CG-MCP) to centralize domestic regulations and align international cyber standards across critical port infrastructure, strategic sealift assets, and commercial shipping networks.
leadershipawardsus coast guardcybersecuritymaritime securityRead signal - Government ContractingSep 2, 20262 min · By Defense Signals Desk
DOW Partners With Lockheed and General Dynamics to Scale PAC-3, THAAD Output
Signal ProDOW has secured seven-year supply agreements with General Dynamics and Lockheed Martin to expand raw material capacity for PAC-3 and THAAD missile production. The long-term commitments aim to resolve critical defense supply chain bottlenecks and accelerate missile defense output.
leadershipawardslockheed martingeneral dynamicspac-3Read signal - Government ContractingSep 2, 20262 min · By Defense Signals Desk
DOW Solicits Industry Capabilities for Software-Only Post-Quantum Cryptography
Signal ProThe Department of the Navy is requesting industry feedback on software-based post-quantum encryption solutions designed to secure critical communications without requiring expensive or time-consuming hardware modifications to existing radios and cryptographic equipment.
leadershipawardspost-quantum cryptographycybersecuritytactical communicationsRead signal - Government ContractingSep 2, 20262 min · By Defense Signals Desk
SBA Deputy Director to Target AI, Cyber, and Small Business GovCon Capital Access
Signal ProSBA Deputy Director Bill Briggs will address small business capital access, artificial intelligence adoption, and contracting opportunities at the 2026 FedCiv Summit, emphasizing key growth pathways for SDVOSBs and 8(a) firms across federal networks.
leadershipawardssbagovconsmall businessRead signal - Government ContractingAug 27, 20262 min · By Defense Signals Desk
NSA Releases Microelectronics Guidance Targeting ASIC Security Threats
Signal ProThe National Security Agency issued new security guidance targeting Application-Specific Integrated Circuit (ASIC) threats, publishing a threat catalog and baseline assurance standard. The guidelines help defense acquisition officials and contractors secure microelectronics supply chains against hardware vulnerabilities.
leadershipawardsnsaasicmicroelectronicsRead signal - Government ContractingAug 27, 20262 min · By Defense Signals Desk
DOJ Establishes National Fraud Detection Center to Combat Cross-Agency Schemes
Signal ProThe Department of Justice has launched the National Fraud Detection Center alongside the FBI and Homeland Security Investigations to target complex, multi-agency fraud schemes. The initiative signals heightened regulatory oversight and data-driven enforcement across federal procurement, grant funding, and defense contracting.
leadershipawardsdojfraud detectionfederal procurementRead signal - Government ContractingAug 27, 20262 min · By Defense Signals Desk
SBA and Defense Leadership Launch Commission to Mobilize Small Manufacturers
Signal ProThe SBA and defense leaders have established the Smaller War Plants Commission to strengthen sub-tier manufacturing capacity, expand capital access for small firms, and de-risk critical defense supply chains.
leadershipawardssbadefense industrial basesmall businessRead signal - Government ContractingAug 26, 20262 min · By Defense Signals Desk
Navy Names Andrew Magliochetti DASN for Industrial Base Revitalization
Signal ProActing Navy Secretary Hung Cao has appointed Andrew Magliochetti as Deputy Assistant Secretary of the Navy for the Defense Industrial Base. Magliochetti will oversee strategic initiatives to strengthen supply chain resiliency, expand shipyard capacity, and accelerate naval fleet readiness.
leadershipawardsnavydefense industrial baseshipbuildingRead signal - Government ContractingAug 22, 20262 min · By Defense Signals Desk
US, Australian Navies Launch TALON to Modernize MH-60 Fleets
Signal ProThe U.S. Navy and Royal Australian Navy have launched Project TALON, a joint program to modernize their shared MH-60 Seahawk maritime helicopter fleets. Industry primes Sierra Nevada Corp., Lockheed Martin, and Collins Aerospace have been selected to deliver advanced mission capability updates.
leadershipawardsmh-60 seahawkus navyroyal australian navyRead signal - Government ContractingAug 22, 20262 min · By Defense Signals Desk
DoD Directs Automated Access to Defense Contractor Financial Systems
Signal ProA new Pentagon memorandum directs the development of software to automate direct access to defense contractors' financial systems, signaling a major shift toward real-time oversight, financial transparency, and automated audit capabilities across the defense industrial base.
leadershipawardsdodgovernment contractingdefense acquisitionRead signal - Defense AcquisitionAug 22, 20262 min · By Defense Signals Desk
DIU Launches Bridge Program to Accelerate Commercial Tech Adoption
Signal ProThe Defense Innovation Unit has launched the Bridge Program, led by Sarah Pearson, to bridge the defense acquisition 'Valley of Death' and speed up military scaling of commercial dual-use technologies.
leadershipawardsdiudefense acquisitioncommercial techRead signal - Government ContractingAug 21, 20262 min · By Defense Signals Desk
Air Force Seeks Industry Input for Sensor-Agnostic DCGS Training Emulator
Signal ProThe U.S. Air Force has issued a Request for Information for a sensor-agnostic emulator trainer to support the modernization of its Distributed Common Ground System. This initiative aims to streamline intelligence operator training across diverse airborne and orbital collection platforms.
leadershipawardsair forcedcgsrfiRead signal - Government ContractingAug 21, 20262 min · By Defense Signals Desk
NASA Funds $10.5M State-Hub Network to Expand Aerospace Workforce
Signal ProNASA has allocated $10.5 million across seven educational institutions to establish state-level technical training hubs. The initiative addresses critical labor shortages in the U.S. aerospace sector, strengthening the defense industrial base and civil space mission readiness.
leadershipawardsnasaaerospace workforcedefense industrial baseRead signal - Government ContractingAug 21, 20262 min · By Defense Signals Desk
GAO Flags Unresolved NASA Oversight Risks as Space Agency Faces Scrutiny
Signal ProThe GAO has called on NASA to address four unresolved high-priority oversight recommendations out of 46 total directives. The lingering gaps signal tighter contract compliance, enhanced financial scrutiny, and potential program oversight shifts across federal space acquisitions.
leadershipawardsnasagaogovernment contractingRead signal - Government ContractingAug 21, 20262 min · By Defense Signals Desk
Social Security Administration Solicits Industry Input for Enterprise AI Strategy
Signal ProThe Social Security Administration has issued an RFI focused on enterprise AI infrastructure and talent acquisition. The initiative reflects a broader federal push to scale operational AI and modernize high-volume data systems.
leadershipawardsssaartificial intelligencerfiRead signal - Government ContractingAug 11, 20262 min · By Defense Signals Desk
Space Force Sets 2027 Flight Demos for Golden Dome Interceptors
Signal ProThe U.S. Space Force is accelerating its Golden Dome missile defense architecture, targeting preliminary capability demonstrations by late 2026 and prototype flight testing for space-based orbital interceptors in 2027 to counter hypersonic and ballistic threats.
leadershipawardsspace forcegolden domemissile defenseRead signal - Government ContractingAug 11, 20262 min · By Defense Signals Desk
Senate Confirms David Cummins as TSA Chief, Signaling Tech Push
Signal ProThe U.S. Senate confirmed David Cummins as TSA administrator. Bringing private-sector patent experience, Cummins aims to accelerate the deployment of advanced security technologies across national transportation networks.
leadershipawardstsadavid cumminshomeland securityRead signal - Government ContractingAug 11, 20262 min · By Defense Signals Desk
Pentagon Weighs Contract Accounting Reforms to Align Defense Audit Rules With GAAP
Signal ProThe Department of Defense is soliciting feedback from the defense industrial base on proposed contract accounting reforms. The initiative aims to align defense audit standards with Generally Accepted Accounting Principles (GAAP), streamlining compliance and reducing barriers for commercial tech vendors.
leadershipawardsdefense acquisitiondcaagaapRead signal - Government ContractingAug 11, 20262 min · By Defense Signals Desk
Rear Adm. Pete Small Takes Acting Command of NAVSEA Following VADM Downey Retirement
Signal ProRear Adm. Pete Small has assumed acting command of Naval Sea Systems Command following the retirement of Vice Adm. James Downey after 40 years of naval service. Rear Adm. Todd Weeks also takes over as portfolio acquisition executive for industrial operations during this critical transition.
leadershipawardsnavseanavydefense acquisitionRead signal - Artificial IntelligenceAug 9, 20262 min · By Defense Signals Desk
US Marine Corps and NPS Partner to Accelerate Military AI Prototypes
Signal ProMarine Corps University and the Naval Postgraduate School are hosting a joint hackathon to develop artificial intelligence and machine learning prototypes for military training, education, and administration, opening doors for commercial tech leaders and cross-service partners.
leadershipawardsmarine corpsartificial intelligencenaval postgraduate schoolRead signal - Government ContractingAug 9, 20262 min · By Defense Signals Desk
Tobyhanna Army Depot, Darkhive Partner in First-Ever Title 10 §7544 sUAS Agreement
Signal ProTobyhanna Army Depot and defense tech firm Darkhive have executed a historic public-private agreement to advance sUAS manufacturing and lifecycle management. The partnership represents the first-ever implementation of 10 U.S.C. § 7544.
leadershipawardssuastobyhanna army depotdarkhiveRead signal - Government ContractingAug 9, 20262 min · By Defense Signals Desk
DHA Solicits Commercial Solutions to Modernize PEO DHMS Test Infrastructure
Signal ProThe Defense Health Agency is calling on commercial vendors to overhaul aging test infrastructure supporting PEO DHMS. By transitioning to firm-fixed-price, outcome-based contracts, the agency seeks to eliminate bloated, legacy hardware footprints and accelerate health IT deployments.
leadershipawardsdhapeo dhmshealth itRead signal - Government ContractingAug 9, 20262 min · By Defense Signals Desk
CBP Field Operations Releases FY2026-2030 Strategy to Bolster Border Tech
Signal ProU.S. Customs and Border Protection’s Office of Field Operations has unveiled its FY2026–2030 strategic roadmap, targeting national and economic security enhancements. The strategy prioritizes advanced artificial intelligence adoption, investigative intelligence integration, and critical infrastructure modernization across ports of entry.
leadershipawardscbphomeland securityartificial intelligenceRead signal - Government ContractingAug 7, 20262 min · By Defense Signals Desk
USAF Test Pilot School Completes Parallel AI Flight Tests on X-62 VISTA
Signal ProThe U.S. Air Force Test Pilot School has successfully completed two parallel, accelerated test campaigns on the X-62 VISTA aircraft, validating AI-driven sensor-to-vehicle controls and advancing rapid software integration for autonomous air combat systems.
leadershipawardsusafx-62 vistaartificial intelligenceRead signal - Government ContractingAug 7, 20262 min · By Defense Signals Desk
Army Combined Arms Command Pilots VICTOR AI Tactical Knowledge Platform
Signal ProThe U.S. Army's Combined Arms Command is piloting VICTOR, a mobile-first artificial intelligence platform that integrates Army doctrine and field lessons learned into existing operational systems to accelerate tactical decision-making ahead of a planned force-wide rollout this fall.
leadershipawardsus armyartificial intelligencecombined arms commandRead signal - Government ContractingAug 7, 20262 min · By Defense Signals Desk
US Army Accelerates Service Acquisitions With AI-Assisted Army MAX Pilot
Signal ProThe U.S. Army has launched a pilot for Army MAX, a cloud-based, AI-assisted platform designed to streamline service acquisitions. By automating requirements validation and package creation, the system aims to significantly reduce administrative delays across the service's contracting workflow.
leadershipawardsus armyaidefense acquisitionRead signal - Government ContractingAug 7, 20262 min · By Defense Signals Desk
Navy Elevates Autonomous Warfare with New DRPM for Robotic Systems
Signal ProThe U.S. Navy has established a Direct Reporting Portfolio Manager for Robotic and Autonomous Systems to streamline acquisition pathways, accelerate capability fielding, and align uncrewed operational tech across multi-domain fleet operations.
leadershipawardsus navyautonomous systemsdefense acquisitionRead signal - Government ContractingAug 6, 20262 min · By Defense Signals Desk
US Army Establishes Project Management Offices for Cyber and Space
Signal ProThe U.S. Army has created two dedicated Project Management Offices—PM Cyber Warfare and PM Space Superiority and Exploitation—to unify acquisition, streamline fielding, and deliver operational intelligence across non-kinetic domains.
leadershipawardsus armycyber warfarespace superiorityRead signal - Government ContractingAug 6, 20262 min · By Defense Signals Desk
NASA Advances Four Commercial Cargo Landers for Artemis Lunar Base Infrastructure
Signal ProNASA has released a progress update detailing four commercial lander developments from Blue Origin, Firefly Aerospace, Intuitive Machines, and Voyager Lunar Systems. Targeted for delivery by 2028, these platforms form the logistical backbone for long-term lunar surface operations.
leadershipawardsnasalunar landerscommercial spaceRead signal
- 01The Pentagon's $1.2B pivot on autonomous logistics is quieter than it looks — and larger than it sounds.
- 02CISA's new OT advisory changes the risk math for three utility operators.
- 03DoD's Trustworthy AI framework quietly redraws the vendor shortlist.
- 04Space Force's proliferated architecture just added a fourth commercial partner.
